
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-XPA Antibody
상품 한눈에 보기
인간 XPA 단백질을 인식하는 토끼 유래 폴리클로날 항체. DNA 복구 관련 단백질 연구에 적합하며, PrEST 항원을 이용해 친화 정제됨. 인간에 대한 반응성이 검증되었으며, 마우스 및 랫과 높은 서열 유사성을 가짐. 글리세롤 및 PBS 완충액에 보존.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA056856-100 Anti-XPA Antibody, xeroderma pigmentosum, complementation group A 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA056856-25 Anti-XPA Antibody, xeroderma pigmentosum, complementation group A 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-XPA Antibody
Anti-XPA Antibody
Target Protein: xeroderma pigmentosum, complementation group A (XPA)
Supplier: Atlas Antibodies
Product Description
Polyclonal antibody against human XPA protein, involved in nucleotide excision repair. Suitable for research on DNA repair mechanisms and related pathways.
Alternative Gene Names
XP1, XPAC
Target Information
- Target Protein: xeroderma pigmentosum, complementation group A
- Target Gene: XPA
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
FMDSYLMNHFDLPTCDNCRDADDKHKLITKTEAKQEYLLKDCDLEKREPPLKFIVKKNPHHSQWGDMKLYLKLQIVKRSLEV
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Rat: ENSRNOG00000009576 (93%)
- Mouse: ENSMUSG00000028329 (91%)
Recommended Applications
Immunocytochemistry (ICC)
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Reference Documents
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



