
Atlas Antibodies Anti-XPA Antibody
상품 한눈에 보기
인간 XPA 단백질을 인식하는 토끼 유래 폴리클로날 항체. DNA 복구 관련 단백질 연구에 적합하며, PrEST 항원을 이용해 친화 정제됨. 인간에 대한 반응성이 검증되었으며, 마우스 및 랫과 높은 서열 유사성을 가짐. 글리세롤 및 PBS 완충액에 보존.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-XPA Antibody
Target Protein: xeroderma pigmentosum, complementation group A (XPA)
Supplier: Atlas Antibodies
Product Description
Polyclonal antibody against human XPA protein, involved in nucleotide excision repair. Suitable for research on DNA repair mechanisms and related pathways.
Alternative Gene Names
XP1, XPAC
Target Information
- Target Protein: xeroderma pigmentosum, complementation group A
- Target Gene: XPA
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
FMDSYLMNHFDLPTCDNCRDADDKHKLITKTEAKQEYLLKDCDLEKREPPLKFIVKKNPHHSQWGDMKLYLKLQIVKRSLEV
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Rat: ENSRNOG00000009576 (93%)
- Mouse: ENSMUSG00000028329 (91%)
Recommended Applications
Immunocytochemistry (ICC)
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Reference Documents
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-XPNPEP3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-XPO4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-XPA Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-XPNPEP2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-XPNPEP1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.