Atlas Antibodies Anti-XPA Antibody

상품 한눈에 보기

인간 XPA 단백질을 인식하는 토끼 유래 폴리클로날 항체. DNA 복구 관련 단백질 연구에 적합하며, PrEST 항원을 이용해 친화 정제됨. 인간에 대한 반응성이 검증되었으며, 마우스 및 랫과 높은 서열 유사성을 가짐. 글리세롤 및 PBS 완충액에 보존.

카탈로그번호: HPA056856-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA056856-100 Anti-XPA Antibody, xeroderma pigmentosum, complementation group A 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA056856-25 Anti-XPA Antibody, xeroderma pigmentosum, complementation group A 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-XPA Antibody

Anti-XPA Antibody

Target Protein: xeroderma pigmentosum, complementation group A (XPA)
Supplier: Atlas Antibodies

Product Description

Polyclonal antibody against human XPA protein, involved in nucleotide excision repair. Suitable for research on DNA repair mechanisms and related pathways.

Alternative Gene Names

XP1, XPAC

Target Information

Target Protein: xeroderma pigmentosum, complementation group A
Target Gene: XPA
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
```
FMDSYLMNHFDLPTCDNCRDADDKHKLITKTEAKQEYLLKDCDLEKREPPLKFIVKKNPHHSQWGDMKLYLKLQIVKRSLEV
```

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat: ENSRNOG00000009576 (93%)
Mouse: ENSMUSG00000028329 (91%)

Recommended Applications

Immunocytochemistry (ICC)

Specifications

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using PrEST antigen as affinity ligand