
원본
Atlas Antibodies Anti-XPNPEP1 Antibody
상품 한눈에 보기
Human XPNPEP1 단백질을 표적으로 하는 rabbit polyclonal 항체로, IHC, WB, ICC 등에 사용 가능. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 보장. 인체 반응성 검증 완료.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA030422-100 Anti-XPNPEP1 Antibody, X-prolyl aminopeptidase (aminopeptidase P) 1, soluble 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA030422-25 Anti-XPNPEP1 Antibody, X-prolyl aminopeptidase (aminopeptidase P) 1, soluble 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-XPNPEP1 Antibody
Anti-XPNPEP1 Antibody
X-prolyl aminopeptidase (aminopeptidase P) 1, soluble
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB, Independent validation)
- Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against Human XPNPEP1
Alternative Gene Names
XPNPEP, XPNPEPL, XPNPEPL1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | X-prolyl aminopeptidase (aminopeptidase P) 1, soluble |
| Target Gene | XPNPEP1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | AIIGLETIMLFIDGDRIDAPSVKEHLLLDLGLEAEYRIQVHPYKSILSELKALCADLSPREKVWVSDKASYAVSETIPKDHRCC |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000025027 (93%), Rat ENSRNOG00000012084 (92%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



