CacheBy
Atlas Antibodies Anti-XPNPEP1 Antibody
원본

Atlas Antibodies Anti-XPNPEP1 Antibody

상품 한눈에 보기

Human XPNPEP1 단백질을 표적으로 하는 rabbit polyclonal 항체로, IHC, WB, ICC 등에 사용 가능. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 보장. 인체 반응성 검증 완료.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA030422-100 Anti-XPNPEP1 Antibody, X-prolyl aminopeptidase (aminopeptidase P) 1, soluble 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA030422-25 Anti-XPNPEP1 Antibody, X-prolyl aminopeptidase (aminopeptidase P) 1, soluble 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-XPNPEP1 Antibody

Anti-XPNPEP1 Antibody

X-prolyl aminopeptidase (aminopeptidase P) 1, soluble

  • Immunohistochemistry (IHC)
  • Western Blot (WB, Independent validation)
    • Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human XPNPEP1

Alternative Gene Names

XPNPEP, XPNPEPL, XPNPEPL1

Open Datasheet

Target Information

항목 내용
Target Protein X-prolyl aminopeptidase (aminopeptidase P) 1, soluble
Target Gene XPNPEP1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence AIIGLETIMLFIDGDRIDAPSVKEHLLLDLGLEAEYRIQVHPYKSILSELKALCADLSPREKVWVSDKASYAVSETIPKDHRCC
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000025027 (93%), Rat ENSRNOG00000012084 (92%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Independent Validation
Independent Validation Tooltip
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.