Atlas Antibodies Anti-XPNPEP2 Antibody

상품 한눈에 보기

인간 XPNPEP2 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 RNA-seq 데이터 비교를 통한 정교한 단백질 발현 검증에 적합. 토끼 유래 IgG 항체이며, 고순도 친화 정제 방식으로 생산. 인간 시료에 높은 반응성을 보이며, 연구용으로 최적화됨.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA000339-100 Anti-XPNPEP2 Antibody, X-prolyl aminopeptidase (aminopeptidase P) 2, membrane-bound 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA000339-25 Anti-XPNPEP2 Antibody, X-prolyl aminopeptidase (aminopeptidase P) 2, membrane-bound 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

X-prolyl aminopeptidase (aminopeptidase P) 2, membrane-bound

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Polyclonal antibody against human XPNPEP2.
Open Datasheet

항목	내용
Target Protein	X-prolyl aminopeptidase (aminopeptidase P) 2, membrane-bound
Target Gene	XPNPEP2
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Identity	Mouse ENSMUSG00000037005 (77%), Rat ENSRNOG00000004009 (75%)

Antigen Sequence

VRSQMQKHQKVPTAVLLSALEETAWLFNLRASDIPYNPFFYSYTLLTDSSIRLFANKSRFSSETLSYLNSSCTGPMCVQIEDYSQVRDSIQAYSLGDVRIWIGTSYTMYGI

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method	Affinity purified using the PrEST antigen as affinity ligand