CacheBy
Atlas Antibodies Anti-XPNPEP2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-XPNPEP2 Antibody

상품 한눈에 보기

인간 XPNPEP2 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 RNA-seq 데이터 비교를 통한 정교한 단백질 발현 검증에 적합. 토끼 유래 IgG 항체이며, 고순도 친화 정제 방식으로 생산. 인간 시료에 높은 반응성을 보이며, 연구용으로 최적화됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA000339-100 Anti-XPNPEP2 Antibody, X-prolyl aminopeptidase (aminopeptidase P) 2, membrane-bound 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA000339-25 Anti-XPNPEP2 Antibody, X-prolyl aminopeptidase (aminopeptidase P) 2, membrane-bound 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-XPNPEP2 Antibody

Anti-XPNPEP2 Antibody

X-prolyl aminopeptidase (aminopeptidase P) 2, membrane-bound

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal antibody against human XPNPEP2.
Open Datasheet

Target Information

항목 내용
Target Protein X-prolyl aminopeptidase (aminopeptidase P) 2, membrane-bound
Target Gene XPNPEP2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000037005 (77%), Rat ENSRNOG00000004009 (75%)

Antigen Sequence

VRSQMQKHQKVPTAVLLSALEETAWLFNLRASDIPYNPFFYSYTLLTDSSIRLFANKSRFSSETLSYLNSSCTGPMCVQIEDYSQVRDSIQAYSLGDVRIWIGTSYTMYGI

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.