CacheBy
Atlas Antibodies Anti-XPNPEP3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-XPNPEP3 Antibody

상품 한눈에 보기

인간 XPNPEP3 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에서 정교한 정합 검증 수행. APP3, NPHPL1 대체 유전자명으로 알려짐. 고순도 친화 정제 방식으로 제조되어 높은 특이성과 재현성 제공.

카탈로그번호
HPA000527-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA000527-100 Anti-XPNPEP3 Antibody, X-prolyl aminopeptidase (aminopeptidase P) 3, putative 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA000527-25 Anti-XPNPEP3 Antibody, X-prolyl aminopeptidase (aminopeptidase P) 3, putative 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-XPNPEP3 Antibody

Anti-XPNPEP3 Antibody

X-prolyl aminopeptidase (aminopeptidase P) 3, putative


  • IHC (Immunohistochemistry)
    Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • WB (Western Blot)
    Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Product Description

Polyclonal antibody against Human XPNPEP3


Alternative Gene Names

APP3, NPHPL1

Open Datasheet


Target Information

항목 내용
Target Protein X-prolyl aminopeptidase (aminopeptidase P) 3, putative
Target Gene XPNPEP3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

Epitope Sequence:
THPHLLRPGEVTPGLSQVEYALRRHKLMSLIQKEAQGQSGTDQTVVVLSNPTYYMSNDIPYTFHQDNNFLYLCGFQEPDSILVLQSLPGKQLPSHKAILFVPRRDPSRELWDGPRSGTDGAIALTGVDEAYTLEEFQHLLPKMKAETNMVWYDWMRPSHAQLHSDYMQ


Verified Species Reactivity

  • Human
  • Rat

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000022401 92%
Rat ENSRNOG00000019196 90%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
WB Orthogonal Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.