
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-XPNPEP3 Antibody
상품 한눈에 보기
인간 XPNPEP3 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에서 정교한 정합 검증 수행. APP3, NPHPL1 대체 유전자명으로 알려짐. 고순도 친화 정제 방식으로 제조되어 높은 특이성과 재현성 제공.
- 카탈로그번호
- HPA000527-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA000527-100 Anti-XPNPEP3 Antibody, X-prolyl aminopeptidase (aminopeptidase P) 3, putative 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA000527-25 Anti-XPNPEP3 Antibody, X-prolyl aminopeptidase (aminopeptidase P) 3, putative 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-XPNPEP3 Antibody
Anti-XPNPEP3 Antibody
X-prolyl aminopeptidase (aminopeptidase P) 3, putative
Recommended Applications
- IHC (Immunohistochemistry)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. - WB (Western Blot)
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
Product Description
Polyclonal antibody against Human XPNPEP3
Alternative Gene Names
APP3, NPHPL1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | X-prolyl aminopeptidase (aminopeptidase P) 3, putative |
| Target Gene | XPNPEP3 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
Epitope Sequence:
THPHLLRPGEVTPGLSQVEYALRRHKLMSLIQKEAQGQSGTDQTVVVLSNPTYYMSNDIPYTFHQDNNFLYLCGFQEPDSILVLQSLPGKQLPSHKAILFVPRRDPSRELWDGPRSGTDGAIALTGVDEAYTLEEFQHLLPKMKAETNMVWYDWMRPSHAQLHSDYMQ
Verified Species Reactivity
- Human
- Rat
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000022401 | 92% |
| Rat | ENSRNOG00000019196 | 90% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



