Atlas Antibodies Anti-XPNPEP1 Antibody

상품 한눈에 보기

Human XPNPEP1 단백질을 표적으로 하는 고품질 Rabbit Polyclonal 항체. IHC, WB, ICC에 적합하며 독립 항체 검증으로 신뢰성 향상. PrEST 항원 기반 친화 정제 및 높은 종간 반응성 확보.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA030419-100 Anti-XPNPEP1 Antibody, X-prolyl aminopeptidase (aminopeptidase P) 1, soluble 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA030419-25 Anti-XPNPEP1 Antibody, X-prolyl aminopeptidase (aminopeptidase P) 1, soluble 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

X-prolyl aminopeptidase (aminopeptidase P) 1, soluble

IHC (Immunohistochemistry)
WB (Western Blot) — Independent antibody validation: Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
ICC (Immunocytochemistry)

Polyclonal antibody against Human XPNPEP1

XPNPEP, XPNPEPL, XPNPEPL1

항목	내용
Target Protein	X-prolyl aminopeptidase (aminopeptidase P) 1, soluble
Target Gene	XPNPEP1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Identity	Mouse ENSMUSG00000025027 (93%), Rat ENSRNOG00000012084 (92%)

Antigen Sequence:

AIIGLETIMLFIDGDRIDAPSVKEHLLLDLGLEAEYRIQVHPYKSILSELKALCADLSPREKVWVSDKASYAVSETIPKDHRCC

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand