
Atlas Antibodies Anti-IARS2 Antibody
상품 한눈에 보기
Human IARS2 단백질을 인식하는 토끼 폴리클로날 항체로, WB 검증 완료. PrEST 항원을 이용해 친화 정제됨. 인간 IARS2 단백질 발현 연구용으로 적합하며, 높은 종간 보존성을 가짐.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-IARS2 Antibody
Target: isoleucyl-tRNA synthetase 2, mitochondrial
Supplier: Atlas Antibodies
Recommended Applications
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal Antibody against Human IARS2
Alternative Gene Names
- FLJ10326
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | isoleucyl-tRNA synthetase 2, mitochondrial |
| Target Gene | IARS2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | NVIHPDVVVNGGQDQSKEPPYGADVLRWWVADSNVFTEVAIGPSVLNAARDDISKLRNTLRFLLGNVADFNPETDSIPVNDMYV |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000026618 (79%), Rat ENSRNOG00000002368 (77%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 항목 | 내용 |
|---|---|
| Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-IBA57 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-IBA57 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-IARS2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-IBA57 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-IARS2 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.