Atlas Antibodies Anti-IARS2 Antibody

상품 한눈에 보기

Human IARS2 단백질을 인식하는 Rabbit Polyclonal 항체로, WB 검증 완료. 미토콘드리아 isoleucyl-tRNA synthetase 2를 타깃으로 하며, PrEST 항원을 이용해 친화 정제됨. Human에 반응하며 40% glycerol/PBS buffer에 보존.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA024594-100 Anti-IARS2 Antibody, isoleucyl-tRNA synthetase 2, mitochondrial 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA024594-25 Anti-IARS2 Antibody, isoleucyl-tRNA synthetase 2, mitochondrial 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-IARS2 Antibody

Anti-IARS2 Antibody

Target: isoleucyl-tRNA synthetase 2, mitochondrial
Supplier: Atlas Antibodies

Recommended Applications

WB (Western Blot)
Validation of protein expression by comparing independent antibodies targeting different epitopes of the protein

Product Description

Polyclonal Antibody against Human IARS2

Alternative Gene Names

FLJ10326

Open Datasheet (PDF)

Target Information

항목	내용
Target Protein	isoleucyl-tRNA synthetase 2, mitochondrial
Target Gene	IARS2
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Identity	Mouse ENSMUSG00000026618 (79%), Rat ENSRNOG00000002368 (77%)

Antigen Sequence:

NVIHPDVVVNGGQDQSKEPPYGADVLRWWVADSNVFTEVAIGPSVLNAARDDISKLRNTLRFLLGNVADFNPETDSIPVNDMYV

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)