CacheBy
Atlas Antibodies Anti-IBA57 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-IBA57 Antibody

상품 한눈에 보기

Human IBA57 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB(재조합 발현) 검증 완료. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. 인간 시료에 최적화된 연구용 항체.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA030557-100 Anti-IBA57 Antibody, IBA57, iron-sulfur cluster assembly homolog (S. cerevisiae) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA030557-25 Anti-IBA57 Antibody, IBA57, iron-sulfur cluster assembly homolog (S. cerevisiae) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-IBA57 Antibody

Anti-IBA57 Antibody

IBA57 (iron-sulfur cluster assembly homolog, S. cerevisiae)

  • IHC (Immunohistochemistry)
  • WB (Western Blot, Recombinant Expression Validation)

Recombinant expression validation in WB using target protein overexpression.

Product Description

Polyclonal antibody against human IBA57.

Alternative Gene Names

C1orf69, FLJ12734

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein IBA57, iron-sulfur cluster assembly homolog (S. cerevisiae)
Target Gene IBA57
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000049287 (67%), Rat ENSRNOG00000022725 (65%)

Antigen Sequence:
FPVRFLDPLPTSGITPGATVLTASGQTVGKFRAGQGNVGLALLWSEKIKGPLHIRASEGAQVALAASVPDWWPTVSK

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야별 최적 조건은 사용자가 직접 결정해야 합니다.

제품 이미지

Enhanced Validation
IHC Application
WB Recombinant Expression
Recombinant Expression Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.