CacheBy
Atlas Antibodies Anti-IBA57 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-IBA57 Antibody

상품 한눈에 보기

Atlas Antibodies의 Anti-IBA57 항체는 인간 IBA57 단백질을 인식하는 폴리클로날 항체로, IHC 및 Western blot에 적합합니다. Recombinant expression 검증 완료, Rabbit에서 생산된 IgG 형식이며, 높은 특이성과 재현성을 제공합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA030555-100 Anti-IBA57 Antibody, IBA57, iron-sulfur cluster assembly homolog (S. cerevisiae) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA030555-25 Anti-IBA57 Antibody, IBA57, iron-sulfur cluster assembly homolog (S. cerevisiae) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-IBA57 Antibody

Anti-IBA57 Antibody

IBA57, iron-sulfur cluster assembly homolog (S. cerevisiae)


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
    Recombinant expression validation in WB using target protein overexpression.

Product Description

Polyclonal Antibody against Human IBA57


Alternative Gene Names

  • C1orf69
  • FLJ12734

Open Datasheet


Target Information

항목 내용
Target Protein IBA57, iron-sulfur cluster assembly homolog (S. cerevisiae)
Target Gene IBA57
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000049287 (67%), Rat ENSRNOG00000022725 (65%)

Antigen Sequence:
FPVRFLDPLPTSGITPGATVLTASGQTVGKFRAGQGNVGLALLWSEKIKGPLHIRASEGAQVALAASVPDWWPTVSK


Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Recombinant Expression
Recombinant Expression Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.