Thermo Fisher Scientific IL17RE Monoclonal Antibody (46N7E3)
인간 IL17RE 단백질을 인식하는 마우스 단클론 항체로, WB, IHC(P), Flow Cytometry에 적합합니다. 단백질 G로 정제된 비결합형 액상 항체이며, 0.5 mg/mL 농도로 제공됩니다. 단기 4°C, 장기 -20°C 보관 권장.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilutions
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 5–10 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 10 µg/mL |
| Flow Cytometry (Flow) | 5 µg/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Mouse / IgG2b, kappa |
| Class | Monoclonal |
| Type | Antibody |
| Clone | 46N7E3 |
| Immunogen | Recombinant human IL17E (Amino acids 97–199) |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 0.5 mg/mL |
| Purification | Protein G |
| Storage Buffer | PBS with 0.05% BSA |
| Contains | 0.05% sodium azide |
| Storage Conditions | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2717279 |
Product Specific Information
The immunogen corresponds to amino acids 97–199 of human IL17E and includes the sequence:
MVHLLVQkSkkSSTFkFYRRHkMPAPAQRkLLPRRHLSEkSHHISIPSPDISHkGLRSkR~TQPSDPETWESLPRLDSQRHGGPEFSFDLLPEARAIRVTISSGPE.
Target Information
Interleukin 17 receptor E (IL-17RE) shares limited similarity to the receptor of IL-17A, a type I membrane glycoprotein involved in inflammatory and autoimmune diseases such as rheumatoid arthritis. IL-17RE serves as the functional receptor for IL-17C and is implicated in mucosal immunity against intestinal pathogens. IL-17C, produced by epithelial cells in response to bacterial challenge, binds to a receptor complex formed by IL-17RE and IL-17RA, regulating epithelial immune functions in an autocrine manner.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific Estrogen Receptor Beta Monoclonal Antibody (PPZ0506)
642,300원
Thermo Fisher Scientific
Thermo Fisher Scientific IL23R Monoclonal Antibody (15N6C6)
642,300원
Thermo Fisher Scientific
Thermo Fisher Scientific IL17RE Monoclonal Antibody (46N7E3)
642,300원
Thermo Fisher Scientific
Thermo Fisher Scientific PON1 Monoclonal Antibody (4G8D3)
642,300원
Thermo Fisher Scientific
Thermo Fisher Scientific FOLR4 Monoclonal Antibody (TH6)
642,300원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|