Thermo Fisher Scientific IL17RE Monoclonal Antibody (46N7E3)
인간 IL17RE 단백질을 인식하는 마우스 단클론 항체로, WB, IHC(P), Flow Cytometry에 적합합니다. 단백질 G로 정제된 비결합형 액상 항체이며, 0.5 mg/mL 농도로 제공됩니다. 단기 4°C, 장기 -20°C 보관 권장.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific IL17RE Monoclonal Antibody (46N7E3)
Applications and Tested Dilutions
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 5–10 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 10 µg/mL |
| Flow Cytometry (Flow) | 5 µg/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Mouse / IgG2b, kappa |
| Class | Monoclonal |
| Type | Antibody |
| Clone | 46N7E3 |
| Immunogen | Recombinant human IL17E (Amino acids 97–199) |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 0.5 mg/mL |
| Purification | Protein G |
| Storage Buffer | PBS with 0.05% BSA |
| Contains | 0.05% sodium azide |
| Storage Conditions | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2717279 |
Product Specific Information
The immunogen corresponds to amino acids 97–199 of human IL17E and includes the sequence:
MVHLLVQkSkkSSTFkFYRRHkMPAPAQRkLLPRRHLSEkSHHISIPSPDISHkGLRSkR~TQPSDPETWESLPRLDSQRHGGPEFSFDLLPEARAIRVTISSGPE.
Target Information
Interleukin 17 receptor E (IL-17RE) shares limited similarity to the receptor of IL-17A, a type I membrane glycoprotein involved in inflammatory and autoimmune diseases such as rheumatoid arthritis. IL-17RE serves as the functional receptor for IL-17C and is implicated in mucosal immunity against intestinal pathogens. IL-17C, produced by epithelial cells in response to bacterial challenge, binds to a receptor complex formed by IL-17RE and IL-17RA, regulating epithelial immune functions in an autocrine manner.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.