Atlas Antibodies Anti-HMCES Antibody
상품 한눈에 보기
인간 HMCES 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB에서 유전자 및 단백질 수준 검증에 사용 가능. Rabbit 유래 IgG 항체이며 PrEST 항원으로 정제됨. 인간 특이 반응성 확인 및 ES 세포 특이적 hmC 결합 단백질 연구에 적합.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-HMCES Antibody
5-hydroxymethylcytosine (hmC) binding, ES cell-specific
Recommended Applications
Orthogonal validation (IHC)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.Genetic validation (WB)
Genetic validation in WB by siRNA knockdown.ICC
Suitable for immunocytochemistry applications.
Product Description
Polyclonal Antibody against Human HMCES
Alternative Gene Names
C3orf37, DC12, SRAPD1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | 5-hydroxymethylcytosine (hmC) binding, ES cell-specific |
| Target Gene | HMCES |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat (88%), Mouse (87%) |
Antigen Sequence:
WRLLTMAGIFDCWEPPEGGDVLYSYTIITVDSCKGLSDIHHRMPAILDGEEAVSKWLDFGEVSTQEALKLIHPTENITFHAVSSVVNNS
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.