CacheBy
Atlas Antibodies Anti-HMBS Antibody
원본

Atlas Antibodies Anti-HMBS Antibody

상품 한눈에 보기

Human HMBS 단백질을 인식하는 토끼 유래 폴리클로날 항체입니다. IHC 및 WB 실험에 적합하며, 고순도 Affinity 정제 방식으로 제조되었습니다. Human, Mouse, Rat 종에 반응하며 안정적 PBS/glycerol buffer로 보존됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA050659-100 Anti-HMBS Antibody, hydroxymethylbilane synthase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA050659-25 Anti-HMBS Antibody, hydroxymethylbilane synthase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-HMBS Antibody

Anti-HMBS Antibody

Target Information

  • Protein: Hydroxymethylbilane synthase
  • Gene: HMBS
  • Alternative Gene Names: PBGD, PORC, UPS
  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human HMBS.

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Sequence:
    QFEIIAMSTTGDKILDTALSKIGEKSLFTKELEHALEKNEVDLVVHSLKDLPTVLPPGFTIGAICKRENPHDAVVFHPKFVGKTLETLPEKSVVGTSSLRRAAQLQRKFPHLEFRSIRGNLNTRL

Species Reactivity

  • Verified: Human, Mouse, Rat

Interspecies Information

Species Ortholog ID Sequence Identity
Mouse ENSMUSG00000032126 94%
Rat ENSRNOG00000010390 94%

Antibody Characteristics

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using PrEST antigen as affinity ligand

Buffer Composition

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

제품 이미지

IHC Application
WB Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.