
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-HM13 Antibody
상품 한눈에 보기
Human HM13 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB에 적합합니다. Rabbit에서 생산되었으며, PrEST 항원을 이용해 친화 정제되었습니다. Orthogonal validation을 통해 RNA-seq 데이터와 단백질 발현을 비교 검증하였습니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA045089-100 Anti-HM13 Antibody, histocompatibility (minor) 13 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA045089-25 Anti-HM13 Antibody, histocompatibility (minor) 13 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-HM13 Antibody
Anti-HM13 Antibody
Target: histocompatibility (minor) 13
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Orthogonal validation): Protein expression validated by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- WB (Western Blot): Suitable for detection of HM13 protein.
Product Description
Polyclonal antibody against Human HM13.
Alternative Gene Names
dJ324O17.1, H13, IMP1, IMPAS, PSENL3, PSL3, SPP, SPPL1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | histocompatibility (minor) 13 |
| Target Gene | HM13 |
| Antigen Sequence Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Antigen Sequence | PASFPNRQYQLLFTQGSGENKEEIINYEFDTKDLVCLGLSSIVGVWYLLRKHWIANNLFGLAFSLNGVELLHLNNVSTGC |
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Rat ENSRNOG00000007738 (98%)
- Mouse ENSMUSG00000019188 (98%)
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



