CacheBy
Atlas Antibodies Anti-HM13 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-HM13 Antibody

상품 한눈에 보기

Human HM13 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB에 적합합니다. Rabbit에서 생산되었으며, PrEST 항원을 이용해 친화 정제되었습니다. Orthogonal validation을 통해 RNA-seq 데이터와 단백질 발현을 비교 검증하였습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA045089-100 Anti-HM13 Antibody, histocompatibility (minor) 13 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA045089-25 Anti-HM13 Antibody, histocompatibility (minor) 13 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-HM13 Antibody

Anti-HM13 Antibody

Target: histocompatibility (minor) 13
Supplier: Atlas Antibodies


  • IHC (Orthogonal validation): Protein expression validated by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • WB (Western Blot): Suitable for detection of HM13 protein.

Product Description

Polyclonal antibody against Human HM13.


Alternative Gene Names

dJ324O17.1, H13, IMP1, IMPAS, PSENL3, PSL3, SPP, SPPL1


Target Information

항목 내용
Target Protein histocompatibility (minor) 13
Target Gene HM13
Antigen Sequence Type Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence PASFPNRQYQLLFTQGSGENKEEIINYEFDTKDLVCLGLSSIVGVWYLLRKHWIANNLFGLAFSLNGVELLHLNNVSTGC

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000007738 (98%)
  • Mouse ENSMUSG00000019188 (98%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet


Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.


Additional Resources

Open Datasheet (PDF)


제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip
WB

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.