CacheBy
Atlas Antibodies Anti-HM13 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-HM13 Antibody

상품 한눈에 보기

Human HM13 단백질을 인식하는 고품질 폴리클로날 항체. IHC 및 Western blot에 적합하며 RNA-seq 데이터 기반 Orthogonal validation 수행. Rabbit 유래 IgG, PrEST 항원으로 정제된 제품. 인간 반응성 검증 완료.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA056062-100 Anti-HM13 Antibody, histocompatibility (minor) 13 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA056062-25 Anti-HM13 Antibody, histocompatibility (minor) 13 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-HM13 Antibody

Anti-HM13 Antibody

Target: histocompatibility (minor) 13
Supplier: Atlas Antibodies


  • IHC (Orthogonal validation)
  • Western Blot (WB)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal antibody against Human HM13.


Alternative Gene Names

dJ324O17.1, H13, IMP1, IMPAS, PSENL3, PSL3, SPP, SPPL1

Open Datasheet


Specifications

항목 내용
Target Protein histocompatibility (minor) 13
Target Gene HM13
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence PASFPNRQYQLLFTQGSGENKEEIINYEFDTKDLVCLGLSSIVGVWYLLRKHWIANNLFGLAFSLNGVELLHLNNVSTGC
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000007738 (98%), Mouse ENSMUSG00000019188 (98%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip
WB

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.