CacheBy
Atlas Antibodies Anti-GUK1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GUK1 Antibody

상품 한눈에 보기

Human GUK1 단백질을 인식하는 Rabbit Polyclonal Antibody로, WB 등 단백질 발현 검증에 적합합니다. PrEST 항원을 이용한 Affinity 정제 방식으로 높은 특이성과 재현성을 제공합니다. Human에 반응하며 Mouse, Rat과도 부분적 교차 반응성을 가집니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA028118-100 Anti-GUK1 Antibody, guanylate kinase 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA028118-25 Anti-GUK1 Antibody, guanylate kinase 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GUK1 Antibody

Anti-GUK1 Antibody

Target Protein: guanylate kinase 1
Supplier: Atlas Antibodies

Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.

Product Description

Polyclonal Antibody against Human GUK1
Open Datasheet

Target Information

항목 내용
Target Protein guanylate kinase 1
Target Gene GUK1
Verified Species Reactivity Human
Interspecies Information Mouse (65%), Rat (61%)

Antigen Information

항목 내용
Antigen Type Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence GSQETFHLGAPVETTCLAGMSGPRPVVLSGPSGAGKSTLLKRLLQEHSGIFGFSVSHTTRNP

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
WB Independent Validation
Independent Validation Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.