AI 생성

1 / 2

Atlas Antibodies Anti-GUK1 Antibody

상품 한눈에 보기

인간 GUK1 단백질을 인식하는 토끼 폴리클로날 항체로, WB 등 단백질 발현 검증에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공합니다. 글리세롤 및 PBS 완충액에 보존되어 장기 보관이 용이합니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA048587-100 Anti-GUK1 Antibody, guanylate kinase 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA048587-25 Anti-GUK1 Antibody, guanylate kinase 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target Protein: guanylate kinase 1
Target Gene: GUK1

Validation of protein expression in Western Blot (WB) by comparing independent antibodies targeting different epitopes of the protein.

Polyclonal antibody against human GUK1, affinity purified using the PrEST antigen as affinity ligand.

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

GSQETFHLGAPVETTCLAGMSGPRPVVLSGPSGAGKSTLLKRLLQEHSGIFGFSVSHTTRNP

Highest antigen sequence identity to the following orthologs:

Species	Gene ID	Identity
Mouse	ENSMUSG00000020444	65%
Rat	ENSRNOG00000002928	61%

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand

Gently mix before use.
Optimal concentrations and conditions for each application should be determined by the user.

Enhanced Validation
WB Independent Validation
Independent Validation Tooltip

0개

로그인하시면 이 상품에 대해 문의를 남길 수 있어요.

아직 등록된 문의가 없어요.