CacheBy
Atlas Antibodies Anti-GUK1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GUK1 Antibody

상품 한눈에 보기

Human GUK1 단백질을 표적으로 하는 폴리클로날 항체로, WB 검증을 통해 독립적 항체 비교로 단백질 발현 확인 가능. Rabbit 유래 IgG 항체이며, PrEST 항원으로 친화 정제됨. Human에 반응하며, glycerol/PBS buffer에 보존됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA068324-100 Anti-GUK1 Antibody, guanylate kinase 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA068324-25 Anti-GUK1 Antibody, guanylate kinase 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GUK1 Antibody

Anti-GUK1 Antibody

Target Protein: guanylate kinase 1
Supplier: Atlas Antibodies

Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.

Product Description

Polyclonal Antibody against Human GUK1

Open Datasheet

Target Information

항목 내용
Target Protein guanylate kinase 1
Target Gene GUK1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000020444 (65%), Rat ENSRNOG00000002928 (61%)

Antigen Sequence:
GSQETFHLGAPVETTCLAGMSGPRPVVLSGPSGAGKSTLLKRLLQEHSGIFGFSVSHTTRNP

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
WB Independent Validation
Independent Validation Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.