CacheBy
Atlas Antibodies Anti-GUCY2C Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GUCY2C Antibody

상품 한눈에 보기

Human GUCY2C 단백질을 인식하는 Rabbit Polyclonal Antibody로, IHC 등 다양한 응용에 적합합니다. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다. 40% 글리세롤 및 PBS 버퍼로 안정적으로 보관됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA037655-100 Anti-GUCY2C Antibody, guanylate cyclase 2C (heat stable enterotoxin receptor) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA037655-25 Anti-GUCY2C Antibody, guanylate cyclase 2C (heat stable enterotoxin receptor) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GUCY2C Antibody

Anti-GUCY2C Antibody

Target: guanylate cyclase 2C (heat stable enterotoxin receptor)
Supplier: Atlas Antibodies


면역조직화학 (IHC)


Product Description

Polyclonal Antibody against Human GUCY2C


Alternative Gene Names

  • GUC2C
  • STAR

Open Datasheet


Target Information

항목 내용
Target Protein guanylate cyclase 2C (heat stable enterotoxin receptor)
Target Gene GUCY2C
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence EVRGETYLKGRGNETTYWLTGMKDQKFNLPTPPTVENQQRLQAEFSDMIANSLQKRQAAGIRSQKPRRVASYKKGTLEYLQLNTTD
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000009031 (80%), Mouse ENSMUSG00000042638 (79%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet


Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 최적의 농도 및 조건은 사용자 실험 환경에 따라 결정되어야 합니다.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.