AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-GUCA1A Antibody
상품 한눈에 보기
Human GUCA1A를 인식하는 rabbit polyclonal antibody로, retina 관련 연구에 적합. PrEST 항원을 이용해 친화 정제됨. IHC 등 다양한 응용에 사용 가능. PBS/glycerol buffer에 보존되어 안정적.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA075056-100 Anti-GUCA1A Antibody, guanylate cyclase activator 1A 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA075056-25 Anti-GUCA1A Antibody, guanylate cyclase activator 1A 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-GUCA1A Antibody
Anti-GUCA1A Antibody
Target: guanylate cyclase activator 1A (retina)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
Product Description
Polyclonal antibody against human GUCA1A protein.
Alternative Gene Names
C6orf131, COD3, CORD14, dJ139D8.6, GCAP, GCAP1, GUCA, GUCA1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | guanylate cyclase activator 1A (retina) |
| Target Gene | GUCA1A |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | EYVAALSLVLKGKVEQKLRWYFKLYDVDGNGCIDRDELLTIIQAIRAINPCSDTTMTAEEFTDTVFSKIDVNGDGELSLEEFIEGVQKDQMLLDTLTRSLDLTRIVRRLQNGEQDEEGADEAAEAAG |
Species Reactivity
Verified species reactivity: Human
Interspecies Information:
Highest antigen sequence identity to the following orthologs:
- Rat ENSRNOG00000015402 (90%)
- Mouse ENSMUSG00000023982 (88%)
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.