
Atlas Antibodies Anti-GUCA1A Antibody
인간 GUCA1A 단백질을 인식하는 토끼 폴리클로날 항체로, 망막 내 guanylate cyclase activator 1A 연구에 적합합니다. 높은 종간 서열 유사성(쥐 90%, 생쥐 88%)을 가지며, PrEST 항원으로 정제된 고품질 항체입니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-GUCA1A Antibody
Target: guanylate cyclase activator 1A (retina)
Supplier: Atlas Antibodies
Recommended Applications
면역조직화학(IHC)
Product Description
Polyclonal antibody against Human GUCA1A.
Alternative Gene Names
C6orf131, COD3, CORD14, dJ139D8.6, GCAP, GCAP1, GUCA, GUCA1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | guanylate cyclase activator 1A (retina) |
| Target Gene | GUCA1A |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000015402 (90%), Mouse ENSMUSG00000023982 (88%) |
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
EYVAALSLVLKGKVEQKLRWYFKLYDVDGNGCIDRDELLTIIQAIRAINPCSDTTMTAEEFTDTVFSKIDVNGDGELSLEEFIEGVQKDQMLLDTLTRSLDLTRIVRRLQNGEQDEEGADEAAEAAG
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-GUCA1A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GUCA1B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GUCA1A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GUCA1C Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GTSF1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|