
Atlas Antibodies Anti-GUCA2A Antibody
Human GUCA2A(guanylin)을 표적으로 하는 폴리클로날 항체로, IHC 및 WB 실험에 적합. Orthogonal validation 및 recombinant expression으로 검증됨. Rabbit host, IgG isotype, PrEST antigen으로 affinity purified.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-GUCA2A Antibody
Target: guanylate cyclase activator 2A (guanylin)
Supplier: Atlas Antibodies
Recommended Applications
IHC Orthogonal Validation
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.WB Recombinant Expression Validation
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal Antibody against Human GUCA2A
Alternative Gene Names
GUCA2, STARA
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | guanylate cyclase activator 2A (guanylin) |
| Target Gene | GUCA2A |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000023247 (65%), Rat ENSRNOG00000008849 (64%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Antigen Sequence
SLESVKKLKDLQEPQEPRVGKLRNFAPIPGEPVVPILCSNPNFPEELKPLCKEPNAQEILQRLEEIAEDPGTCEICAYAACTGC제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-GUCY1A3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GUCD1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GUCA2A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GUCA1A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GUCA1B Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|