CacheBy
Atlas Antibodies Anti-GUCA2A Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GUCA2A Antibody

상품 한눈에 보기

Human GUCA2A(guanylin)을 표적으로 하는 폴리클로날 항체로, IHC 및 WB 실험에 적합. Orthogonal validation 및 recombinant expression으로 검증됨. Rabbit host, IgG isotype, PrEST antigen으로 affinity purified.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA018215-100 Anti-GUCA2A Antibody, guanylate cyclase activator 2A (guanylin) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA018215-25 Anti-GUCA2A Antibody, guanylate cyclase activator 2A (guanylin) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GUCA2A Antibody

Anti-GUCA2A Antibody

Target: guanylate cyclase activator 2A (guanylin)
Supplier: Atlas Antibodies


  • IHC Orthogonal Validation
    Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

  • WB Recombinant Expression Validation
    Recombinant expression validation in WB using target protein overexpression.


Product Description

Polyclonal Antibody against Human GUCA2A


Alternative Gene Names

GUCA2, STARA

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein guanylate cyclase activator 2A (guanylin)
Target Gene GUCA2A
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000023247 (65%), Rat ENSRNOG00000008849 (64%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Antigen Sequence

SLESVKKLKDLQEPQEPRVGKLRNFAPIPGEPVVPILCSNPNFPEELKPLCKEPNAQEILQRLEEIAEDPGTCEICAYAACTGC

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Tooltip Orthogonal
WB Recombinant Expression
Tooltip Recombinant Expression

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.