
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-GUCD1 Antibody
상품 한눈에 보기
인간 GUCD1 단백질을 표적으로 하는 폴리클로날 항체로, 재조합 발현 검증을 통해 WB 및 ICC 실험에 적합합니다. 토끼 유래 IgG 항체이며, PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 신뢰성을 제공합니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA022786-100 Anti-GUCD1 Antibody, guanylyl cyclase domain containing 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA022786-25 Anti-GUCD1 Antibody, guanylyl cyclase domain containing 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-GUCD1 Antibody
Anti-GUCD1 Antibody
Target: guanylyl cyclase domain containing 1 (GUCD1)
Supplier: Atlas Antibodies
Recommended Applications
- WB (Recombinant Expression): Validation in Western blot using target protein overexpression.
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against human GUCD1.
Alternative Gene Names
C22orf13, LLN4, MGC1842
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | guanylyl cyclase domain containing 1 |
| Target Gene | GUCD1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | MHHFGVRHRFCTQTLGVDKGYKNQSFYRKHFDTEETRVNQLFAQAKACKVLVEKCTVSVKDIQAHLAQGHVAIVLVNSGVLHCDLCS |
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000033416 | 95% |
| Rat | ENSRNOG00000049952 | 69% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
| Notes | Gently mix before use. Optimal concentrations and conditions should be determined by the user. |
| Safety Info | Material Safety Data Sheet |
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



