
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-WAPL Antibody
상품 한눈에 보기
Human WAPL 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 등 단백질 발현 검증에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 보장. Human에서 검증되었으며 Rat, Mouse와 높은 서열 유사성 보유.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA066141-100 Anti-WAPL Antibody, WAPL cohesin release factor 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA066141-25 Anti-WAPL Antibody, WAPL cohesin release factor 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-WAPL Antibody
Anti-WAPL Antibody
WAPL cohesin release factor
Recommended Applications
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal Antibody against Human WAPL
Alternative Gene Names
FOE, KIAA0261, WAPAL
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | WAPL cohesin release factor |
| Target Gene | WAPL |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | IVTALKCRREDKELYTVVQHVKHFNDVVEFGENQEFTDDIEYLLSGLKSTQPLNTRCLSVISLATKCAMPSFRMHLR |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000052513 (99%), Mouse ENSMUSG00000041408 (99%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



