Atlas Antibodies Anti-WARS Antibody

상품 한눈에 보기

인간 WARS 단백질을 인식하는 토끼 폴리클로날 항체로, WB 및 ICC 실험에 적합합니다. RNA-seq 데이터 기반 정교한 Orthogonal 검증을 통해 높은 신뢰성을 제공합니다. 친화 정제 방식으로 제조되어 높은 특이성과 재현성을 보장합니다.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기

Atlas Antibodies HPA005573-100 Anti-WARS Antibody, tryptophanyl-tRNA synthetase 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA005573-25 Anti-WARS Antibody, tryptophanyl-tRNA synthetase 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-WARS Antibody

Anti-WARS Antibody

Target: tryptophanyl-tRNA synthetase
Type: Polyclonal Antibody against Human WARS

Recommended Applications

WB (Western Blot) – Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
ICC (Immunocytochemistry)

Product Description

Polyclonal antibody raised in rabbit against human WARS (tryptophanyl-tRNA synthetase).

Alternative Gene Names

IFI53, IFP53

Open Datasheet

Target Information

항목	내용
Target Protein	tryptophanyl-tRNA synthetase
Target Gene	WARS
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Identity	Mouse ENSMUSG00000021266 (92%), Rat ENSRNOG00000004359 (92%)

Antigen Sequence:
DATEAEEDFVDPWTVQTSSAKGIDYDKLIVRFGSSKIDKELINRIERATGQRPHHFLRRGIFFSHRDMNQVLDAYENKKPFYLYTGRGPSSEAMHVGHLIPFIFTKWLQDVFNVPLVIQMTDDEKYLWKDLTLDQAYSYAVENA

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand