CacheBy
Atlas Antibodies Anti-WAPL Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-WAPL Antibody

상품 한눈에 보기

Atlas Antibodies의 Anti-WAPL Antibody는 인간 WAPL cohesin release factor를 표적으로 하는 고품질 폴리클로날 항체입니다. IHC 독립 검증을 통해 신뢰성 높은 단백질 발현 분석에 적합합니다. Rabbit에서 생산된 IgG 형태로, PrEST 항원 친화 정제 방식으로 제조되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA037875-100 Anti-WAPL Antibody, WAPL cohesin release factor 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA037875-25 Anti-WAPL Antibody, WAPL cohesin release factor 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-WAPL Antibody

Anti-WAPL Antibody

WAPL cohesin release factor

Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.

Product Description

Polyclonal Antibody against Human WAPL

Alternative Gene Names

FOE, KIAA0261, WAPAL

Open Datasheet

Target Information

항목 내용
Target Protein WAPL cohesin release factor
Target Gene WAPL
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000041408 (99%), Rat ENSRNOG00000052513 (99%)

Antigen Sequence

IVTALKCRREDKELYTVVQHVKHFNDVVEFGENQEFTDDIEYLLSGLKSTQPLNTRCLSVISLATKCAMPSFRMHLR

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Independent Validation
Tooltip Independent Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.