CacheBy
Atlas Antibodies Anti-WARS Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-WARS Antibody

상품 한눈에 보기

Human WARS(tryptophanyl-tRNA synthetase)를 인식하는 토끼 폴리클로날 항체. WB 및 ICC에 적합하며 RNA-seq 데이터 기반 정교한 Orthogonal Validation 수행. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성 제공.

카탈로그번호
HPA018944-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA018944-100 Anti-WARS Antibody, tryptophanyl-tRNA synthetase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA018944-25 Anti-WARS Antibody, tryptophanyl-tRNA synthetase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-WARS Antibody

Anti-WARS Antibody

Target: tryptophanyl-tRNA synthetase

  • WB (Western Blot) – Orthogonal validation of protein expression using RNA-seq data comparison in high and low expression cell lines.
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against Human WARS.

Alternative Gene Names

IFI53, IFP53

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein tryptophanyl-tRNA synthetase
Target Gene WARS
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence DATEAEEDFVDPWTVQTSSAKGIDYDKLIVRFGSSKIDKELINRIERATGQRPHHFLRRGIFFSHRDMNQVLDAYENKKPFYLYTGRGPSSEAMHVGHLIPFIFTKWLQDVFNVPLVIQMTDDEKYLWKDLTLDQAYSYAVENA

Verified Species Reactivity

Human

Interspecies Information

Species Gene ID Identity
Rat ENSRNOG00000004359 92%
Mouse ENSMUSG00000021266 92%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
WB Orthogonal Validation
Orthogonal Validation Tooltip
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.