
Atlas Antibodies Anti-UGP2 Antibody
인간 UGP2 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에서 독립 항체 검증 완료. UGP1, UGPP1 대체명으로 알려진 UDP-glucose pyrophosphorylase 2를 타깃하며, 고순도의 친화 정제 항체. 인간, 마우스, 랫트 반응 확인됨.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-UGP2 Antibody
Target: UDP-glucose pyrophosphorylase 2 (UGP2)
Supplier: Atlas Antibodies
Recommended Applications
IHC (Immunohistochemistry)
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.WB (Western Blot)
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal antibody against human UGP2.
Alternative Gene Names
UGP1, UGPP1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | UDP-glucose pyrophosphorylase 2 |
| Target Gene | UGP2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | TVPLVKLGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFGKNVSLKGTVIIIANHGDRIDIPPGAVLENKIVSGNL |
Verified Species Reactivity
Human, Mouse, Rat
Interspecies Information
Highest antigen sequence identity to the following orthologs:
| Species | Gene ID | Identity |
|---|---|---|
| Rat | ENSRNOG00000008079 | 100% |
| Mouse | ENSMUSG00000001891 | 100% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
