Atlas Antibodies Anti-UGP2 Antibody
인간 UGP2 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에서 독립 항체 검증 완료. UGP1, UGPP1 대체명으로 알려진 UDP-glucose pyrophosphorylase 2를 타깃하며, 고순도의 친화 정제 항체. 인간, 마우스, 랫트 반응 확인됨.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Atlas Antibodies · Atlas Antibodies Anti-UGP2 Antibody
Anti-UGP2 Antibody
Target: UDP-glucose pyrophosphorylase 2 (UGP2)
Supplier: Atlas Antibodies
Recommended Applications
IHC (Immunohistochemistry)
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.WB (Western Blot)
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal antibody against human UGP2.
Alternative Gene Names
UGP1, UGPP1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | UDP-glucose pyrophosphorylase 2 |
| Target Gene | UGP2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | TVPLVKLGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFGKNVSLKGTVIIIANHGDRIDIPPGAVLENKIVSGNL |
Verified Species Reactivity
Human, Mouse, Rat
Interspecies Information
Highest antigen sequence identity to the following orthologs:
| Species | Gene ID | Identity |
|---|---|---|
| Rat | ENSRNOG00000008079 | 100% |
| Mouse | ENSMUSG00000001891 | 100% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.