AI 생성

1 / 2

Atlas Antibodies Anti-UGP2 Antibody

상품 한눈에 보기

인간 UGP2 단백질을 표적으로 하는 고품질 폴리클로날 항체. IHC 및 WB에서 독립 항체 검증 완료. 인간, 생쥐, 랫트 반응성 확인. PrEST 항원으로 친화 정제된 고순도 제품. 안정적 PBS-글리세롤 버퍼 포함.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA034697-100 Anti-UGP2 Antibody, UDP-glucose pyrophosphorylase 2 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA034697-25 Anti-UGP2 Antibody, UDP-glucose pyrophosphorylase 2 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target Protein: UDP-glucose pyrophosphorylase 2
Supplier: Atlas Antibodies

IHC (Independent Validation): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
WB (Independent Validation): Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.

Polyclonal Antibody against Human UGP2

UGP1, UGPP1

항목	내용
Target Protein	UDP-glucose pyrophosphorylase 2
Target Gene	UGP2
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human, Mouse, Rat
Interspecies Identity	Rat ENSRNOG00000008079 (100%), Mouse ENSMUSG00000001891 (100%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand

TVPLVKLGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFGKNVSLKGTVIIIANHGDRIDIPPGAVLENKIVSGNL

Gently mix before use.
Optimal concentrations and conditions for each application should be determined by the user.

Enhanced Validation
IHC Independent Validation
WB Independent Validation

0개

로그인하시면 이 상품에 대해 문의를 남길 수 있어요.

아직 등록된 문의가 없어요.