
원본
Atlas Antibodies Anti-UGT1A6 Antibody
상품 한눈에 보기
인체 UGT1A6 단백질을 인식하는 폴리클로날 항체로, IHC 및 RNA-seq 데이터를 통한 정교한 발현 검증에 적합. Rabbit 유래 IgG이며, PrEST 항원으로 친화 정제됨. Human 반응성 확인 및 높은 특이성 제공.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA054065-100 Anti-UGT1A6 Antibody, UDP glucuronosyltransferase 1 family, polypeptide A6 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA054065-25 Anti-UGT1A6 Antibody, UDP glucuronosyltransferase 1 family, polypeptide A6 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-UGT1A6 Antibody
Anti-UGT1A6 Antibody
Target: UDP glucuronosyltransferase 1 family, polypeptide A6
Supplier: Atlas Antibodies
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal antibody against Human UGT1A6.
Alternative Gene Names
GNT1, HLUGP, UGT1F
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | UDP glucuronosyltransferase 1 family, polypeptide A6 |
| Target Gene | UGT1A6 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000018740 (73%), Mouse ENSMUSG00000090124 (63%) |
Antigen Sequence:
WLSMKDIVEVLSDRGHEIVVVVPEVNLLLKESKYYTRKIYPVPYDQEELKNRYQSFGNNHFAERSFLTAPQTEYRNNMIVIGLY
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



