Atlas Antibodies Anti-UGP2 Antibody

상품 한눈에 보기

Human UGP2 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에서 독립 항체 검증을 통해 발현을 확인함. UGP1/UGPP1 대체명으로 알려진 UDP-glucose pyrophosphorylase 2 타깃. 친화 정제 방식으로 높은 특이성과 재현성 제공.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA034696-100 Anti-UGP2 Antibody, UDP-glucose pyrophosphorylase 2 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA034696-25 Anti-UGP2 Antibody, UDP-glucose pyrophosphorylase 2 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-UGP2 Antibody

Anti-UGP2 Antibody

Target Protein: UDP-glucose pyrophosphorylase 2
Supplier: Atlas Antibodies

Recommended Applications

IHC (Immunohistochemistry)
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
WB (Western Blot)
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.

Product Description

Polyclonal antibody against Human UGP2.

Alternative Gene Names

UGP1, UGPP1

Open Datasheet (PDF)

Target Information

항목	내용
Target Protein	UDP-glucose pyrophosphorylase 2
Target Gene	UGP2
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	TVPLVKLGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFGKNVSLKGTVIIIANHGDRIDIPPGAVLENKIVSGNL

Verified Species Reactivity

Human, Mouse, Rat

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000001891 (100%)
Rat ENSRNOG00000008079 (100%)

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method	Affinity purified using the PrEST antigen as affinity ligand