AI 생성

1 / 2

Atlas Antibodies Anti-UGGT2 Antibody

상품 한눈에 보기

인간 UGGT2 단백질을 인식하는 토끼 폴리클로날 항체. UDP-glucose glycoprotein glucosyltransferase 2 검출에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. 인체 시료 연구에 권장.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA047955-100 Anti-UGGT2 Antibody, UDP-glucose glycoprotein glucosyltransferase 2 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA047955-25 Anti-UGGT2 Antibody, UDP-glucose glycoprotein glucosyltransferase 2 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-UGGT2 Antibody

Anti-UGGT2 Antibody

Target: UDP-glucose glycoprotein glucosyltransferase 2
Supplier: Atlas Antibodies

Product Description

Polyclonal antibody against human UGGT2, suitable for research applications.
Affinity purified using the PrEST antigen as affinity ligand.

Alternative Gene Names

FLJ10873, FLJ11485, HUGT2, MGC117360, MGC150689, MGC87276, UGCGL2

Target Information

항목	내용
Target Protein	UDP-glucose glycoprotein glucosyltransferase 2
Target Gene	UGGT2
Verified Species Reactivity	Human
Ortholog Identity	Mouse (66%), Rat (39%)

Antigen Information

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence:

GEMGIVSNGRFLGPLDEDFYAEDFYLLEKITFSNLGEKIKGIVENMGINANNMSDFIMKVDALMSSVPKRASRYDVTFLRENHSVIKTNPQENDMFFNV

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using PrEST antigen

Buffer Composition

구성 성분	내용
Base Buffer	PBS (pH 7.2)
Additives	40% glycerol, 0.02% sodium azide (preservative)
MSDS	Material Safety Data Sheet

Recommended Applications

Immunohistochemistry (IHC)

Notes

Gently mix before use.
Optimal concentrations and conditions should be determined by the user.

Reference

Open Datasheet (PDF)

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

Atlas AntibodiesAtlas Antibodies Anti-UGP2 Antibody528,000원VAT별도

Atlas AntibodiesAtlas Antibodies Anti-UFSP1 Antibody528,000원VAT별도

Atlas AntibodiesAtlas Antibodies Anti-UGGT1 Antibody528,000원VAT별도

문의

0개

로그인하시면 이 상품에 대해 문의를 남길 수 있어요.

아직 등록된 문의가 없어요.