
Atlas Antibodies Anti-TXLNG Antibody
상품 한눈에 보기
인간 TXLNG 단백질을 인식하는 폴리클로날 항체. IHC 및 WB에서 RNA-seq 데이터 기반 정합 검증 완료. 토끼 유래 IgG, PrEST 항원으로 친화 정제. 인간 반응성 검증, 다양한 조직 및 세포주에서 사용 가능.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-TXLNG Antibody
Target: taxilin gamma
Recommended Applications
- IHC (Immunohistochemistry): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- WB (Western Blot): Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
Product Description
Polyclonal antibody against human TXLNG (taxilin gamma).
Alternative Gene Names
CXorf15, FIAT, FLJ11209, LSR5, MGC126621, MGC126625, TXLNGX
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | taxilin gamma |
| Target Gene | TXLNG |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | KALLQMAEEKTVRDKEYKALQIKLERLEKLCRALQTERNELNEKVEVLKEQVSIKAAIKAANRDLATPVMQPCTALDSHKELNTSSKRALGAHLEAEPKSQRSAVQKPPSTGSAP |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000004971 (75%), Mouse ENSMUSG00000038344 (73%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-TXNDC11 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TXN2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TXLNG Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TXLNG Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TXLNB Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.