CacheBy
Atlas Antibodies Anti-TXN2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TXN2 Antibody

상품 한눈에 보기

Human TXN2 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 ICC에 적합합니다. PrEST 항원으로 특이적 친화 정제되었으며, 높은 종 간 보존성을 보입니다. 40% glycerol 기반 PBS buffer에 보존되어 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA000994-100 Anti-TXN2 Antibody, thioredoxin 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA000994-25 Anti-TXN2 Antibody, thioredoxin 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TXN2 Antibody

Anti-TXN2 Antibody

Target Information

  • Target Protein: Thioredoxin 2
  • Target Gene: TXN2
  • Alternative Gene Names: MT-TRX

Product Description

Polyclonal antibody against human TXN2 protein.

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Sequence:
    LTSRALQTPQCSPGGLTVTPNPARTIYTTRISLTTFNIQDGPDFQDRVVNSETPVVVDFHAQWCGPCKILGPRLEKMVAKQHGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQLEAFLKKL

Species Reactivity

  • Verified Species: Human
  • Ortholog Identity:
    • Mouse ENSMUSG00000005354 (91%)
    • Rat ENSRNOG00000005614 (89%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer Composition 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Safety Data Sheet Material Safety Data Sheet

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Reference

Open Datasheet

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.