Atlas Antibodies Anti-TXLNG Antibody

상품 한눈에 보기

Human TXLNG 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB에서 정량적 단백질 발현 분석에 적합합니다. Rabbit 유래 IgG 항체이며, PrEST 항원을 이용해 친화 정제되었습니다. 인간에 대해 검증되었으며 RNA-seq 데이터 기반의 정교한 Orthogonal Validation을 거쳤습니다.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA000297-100 Anti-TXLNG Antibody, taxilin gamma 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA000297-25 Anti-TXLNG Antibody, taxilin gamma 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-TXLNG Antibody

Anti-TXLNG Antibody

Target: taxilin gamma (TXLNG)
Supplier: Atlas Antibodies

Recommended Applications

IHC (Immunohistochemistry): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB (Western Blot): Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Product Description

Polyclonal antibody against human TXLNG.

Alternative Gene Names

CXorf15, FIAT, FLJ11209, LSR5, MGC126621, MGC126625, TXLNGX

Target Information

항목	내용
Target Protein	taxilin gamma
Target Gene	TXLNG
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	KALLQMAEEKTVRDKEYKALQIKLERLEKLCRALQTERNELNEKVEVLKEQVSIKAAIKAANRDLATPVMQPCTALDSHKELNTSSKRALGAHLEAEPKSQRSAVQKPPSTGSAP
Verified Species Reactivity	Human
Interspecies Identity	Rat ENSRNOG00000004971 (75%), Mouse ENSMUSG00000038344 (73%)

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand