CacheBy
Atlas Antibodies Anti-TXLNB Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TXLNB Antibody

상품 한눈에 보기

인간 TXLNB 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB 검증 완료. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. 인간 반응성이 검증되었으며, 다양한 연구 응용에 적합.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA030402-100 Anti-TXLNB Antibody, taxilin beta 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA030402-25 Anti-TXLNB Antibody, taxilin beta 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TXLNB Antibody

Anti-TXLNB Antibody

Taxilin beta


  • Orthogonal validation (IHC): Protein expression validated by comparison to RNA-seq data in tissues with high and low expression.
  • Independent antibody validation (WB): Protein expression confirmed by comparing independent antibodies targeting different epitopes.

Product Description

Polyclonal antibody against Human TXLNB.


Alternative Gene Names

C6orf198, dJ522B19.2, DKFZp451A175, MDP77

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein taxilin beta
Target Gene TXLNB
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence PPLTPQAEAEGGSDAEPPSKASNSPAGLGAETQCEGLPVGAQADQASWKPEAEASGQAPQAPTEASLQKMEADVPAPACAAEEHVAAM
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000060021 (39%), Mouse ENSMUSG00000021910 (38%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip
WB Independent Validation
Independent Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.