AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-GPR137C Antibody
상품 한눈에 보기
Human GPR137C 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. ICC 등 다양한 응용에 적합하며, PrEST 항원으로 친화 정제됨. 인간에 대해 검증된 반응성을 가지며, 40% glycerol 기반 PBS buffer에 보존됨.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA030763-100 Anti-GPR137C Antibody, G protein-coupled receptor 137C 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA030763-25 Anti-GPR137C Antibody, G protein-coupled receptor 137C 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-GPR137C Antibody
Anti-GPR137C Antibody
Target Information
- Target Protein: G protein-coupled receptor 137C
- Target Gene: GPR137C
- Alternative Gene Names: DKFZp762F0713, TM7SF1L2
Product Description
Polyclonal antibody against Human GPR137C, produced in Rabbit.
Affinity purified using the PrEST antigen as affinity ligand.
Recommended for immunocytochemistry (ICC) and related applications.
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
RAQRLNQNLAPAGMINSHSYSSRAYFFDNPRRYDSDDDLPRLGSSREGSLPNSQSLGWYGTMTGCGSSSYTVTPHLNGPMTDTAP
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse (ENSMUSG00000049092): 88%
- Rat (ENSRNOG00000026328): 88%
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen |
| Recommended Applications | ICC and related assays |
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
Additional Documents
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.