
Atlas Antibodies Anti-GPR137C Antibody
상품 한눈에 보기
Human GPR137C 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. ICC 등 다양한 응용에 적합하며, PrEST 항원으로 친화 정제됨. 인간에 대해 검증된 반응성을 가지며, 40% glycerol 기반 PBS buffer에 보존됨.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-GPR137C Antibody
Target Information
- Target Protein: G protein-coupled receptor 137C
- Target Gene: GPR137C
- Alternative Gene Names: DKFZp762F0713, TM7SF1L2
Product Description
Polyclonal antibody against Human GPR137C, produced in Rabbit.
Affinity purified using the PrEST antigen as affinity ligand.
Recommended for immunocytochemistry (ICC) and related applications.
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
RAQRLNQNLAPAGMINSHSYSSRAYFFDNPRRYDSDDDLPRLGSSREGSLPNSQSLGWYGTMTGCGSSSYTVTPHLNGPMTDTAP
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse (ENSMUSG00000049092): 88%
- Rat (ENSRNOG00000026328): 88%
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen |
| Recommended Applications | ICC and related assays |
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
Additional Documents
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-GPR137B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GPR139 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GPR137C Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GPR137C Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GPR132 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.