CacheBy
Atlas Antibodies Anti-GPR132 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GPR132 Antibody

상품 한눈에 보기

Human GPR132 단백질을 인식하는 Rabbit Polyclonal 항체로, Affinity purification 방식으로 정제됨. IHC 등 다양한 응용에 적합하며, 40% glycerol 기반 buffer에 보존됨. G2A로도 알려진 G protein-coupled receptor 132를 타겟으로 함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA029695-100 Anti-GPR132 Antibody, G protein-coupled receptor 132 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA029695-25 Anti-GPR132 Antibody, G protein-coupled receptor 132 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GPR132 Antibody

Anti-GPR132 Antibody

Target: G protein-coupled receptor 132 (GPR132, also known as G2A)

Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against human GPR132.

Alternative Gene Names

G2A

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein G protein-coupled receptor 132
Target Gene GPR132
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000013914 (54%), Mouse ENSMUSG00000021298 (54%)

Antigen Sequence:

HSRQEVSRIHKGWKEWSMKTDVTRLTHSRDTEELQSPVALADHYTFSRPVHPPGSPCPAKRLIEE

Antibody Information

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Applications Icon

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.