CacheBy
Atlas Antibodies Anti-GPR139 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GPR139 Antibody

상품 한눈에 보기

Human GPR139 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 타입입니다. Affinity purification 방식으로 정제되었으며, IHC 등 다양한 연구용 응용에 적합합니다. Human, Rat, Mouse 반응성이 검증되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA046596-100 Anti-GPR139 Antibody, G protein-coupled receptor 139 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA046596-25 Anti-GPR139 Antibody, G protein-coupled receptor 139 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GPR139 Antibody

Anti-GPR139 Antibody

Target Information

  • Target Protein: G protein-coupled receptor 139
  • Target Gene: GPR139
  • Alternative Gene Names: PGR3
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    ISKRFRTMAAATLKAFFKCQKQPVQFYTNHNFSITSSPWISPANSHCIKMLVYQYDK

Product Description

Polyclonal antibody against human GPR139.

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to orthologs:

  • Rat ENSRNOG00000023863 (98%)
  • Mouse ENSMUSG00000066197 (98%)

Immunohistochemistry (IHC)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen as affinity ligand
Verified Reactivity Human, Rat, Mouse
Supplier Atlas Antibodies

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Material Safety Data Sheet
Open Datasheet

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.