Atlas Antibodies Anti-GPR139 Antibody

상품 한눈에 보기

Human GPR139 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 타입입니다. Affinity purification 방식으로 정제되었으며, IHC 등 다양한 연구용 응용에 적합합니다. Human, Rat, Mouse 반응성이 검증되었습니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA046596-100 Anti-GPR139 Antibody, G protein-coupled receptor 139 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA046596-25 Anti-GPR139 Antibody, G protein-coupled receptor 139 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target Protein: G protein-coupled receptor 139
Target Gene: GPR139
Alternative Gene Names: PGR3
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
```
ISKRFRTMAAATLKAFFKCQKQPVQFYTNHNFSITSSPWISPANSHCIKMLVYQYDK
```

Polyclonal antibody against human GPR139.

Highest antigen sequence identity to orthologs:

Immunohistochemistry (IHC)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using PrEST antigen as affinity ligand
Verified Reactivity	Human, Rat, Mouse
Supplier	Atlas Antibodies