AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-GPR137C Antibody
상품 한눈에 보기
Human GPR137C 단백질을 인식하는 토끼 폴리클로날 항체로, 면역세포화학(ICC) 등 다양한 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 인간에 대해 검증된 반응성을 가집니다. 글리세롤 기반 완충용액에 보존되어 있습니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA003640-100 Anti-GPR137C Antibody, G protein-coupled receptor 137C 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA003640-25 Anti-GPR137C Antibody, G protein-coupled receptor 137C 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-GPR137C Antibody
Anti-GPR137C Antibody
Target Information
- Target Protein: G protein-coupled receptor 137C
- Target Gene: GPR137C
- Alternative Gene Names: DKFZp762F0713, TM7SF1L2
Product Description
Polyclonal antibody against human GPR137C.
Recommended for use in immunocytochemistry (ICC) and related applications.
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence:
RAQRLNQNLAPAGMINSHSYSSRAYFFDNPRRYDSDDDLPRLGSSREGSLPNSQSLGWYGTMTGCGSSSYTVTPHLNGPMTDTAP
Verified Species Reactivity
- Human
Interspecies Information
| Species | Ortholog ID | Identity (%) |
|---|---|---|
| Rat | ENSRNOG00000026328 | 88% |
| Mouse | ENSMUSG00000049092 | 88% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.