Thermo Fisher Scientific LYZ Polyclonal Antibody
Thermo Fisher Scientific의 LYZ Polyclonal Antibody는 인간, 마우스, 랫트에 반응하는 Rabbit IgG 폴리클로날 항체입니다. Western blot과 IHC(P) 검증 완료. 항원 친화 크로마토그래피로 정제되었으며, 장기 보관 시 -20°C에서 안정적입니다.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific LYZ Polyclonal Antibody
Applications
Western Blot (WB)
- Tested Dilution: 0.1–0.5 µg/mL
Immunohistochemistry (Paraffin) (IHC (P))
- Tested Dilution: 0.5–1 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human Lysozyme (106–141aa NIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDVRQ) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2884871 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
This gene encodes human lysozyme, whose natural substrate is the bacterial cell wall peptidoglycan (cleaving the β[1–4] glycosidic linkages between N-acetylmuramic acid and N-acetylglucosamine).
Lysozyme is one of the anti-microbial agents found in human milk, and is also present in spleen, lung, kidney, white blood cells, plasma, saliva, and tears.
Missense mutations in LYZ have been identified in heritable renal amyloidosis.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.