Thermo Fisher Scientific Properdin Polyclonal Antibody
Properdin 단백질을 인식하는 Rabbit Polyclonal Antibody로, Human, Mouse, Rat 시료에 반응합니다. Western blot, IHC(P/F), Flow cytometry에 사용 가능하며, 고순도 친화 크로마토그래피 정제 및 동결건조 형태로 제공됩니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilutions
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC-P) | 0.5–1 µg/mL |
| Immunohistochemistry (Frozen) (IHC-F) | 0.5–1 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg / 1×10⁶ cells |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence of human CFP (MVEGQGEKNVTFWGRPLPRCEELQGQKLVVEEKR) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | Store at 4°C (short term). For long term, store at -20°C, avoiding freeze/thaw cycles. |
| Shipping Conditions | Wet ice |
| RRID | AB_2807346 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
This gene encodes a plasma glycoprotein that positively regulates the alternative complement pathway of the innate immune system. The protein binds to microbial surfaces and apoptotic cells, stabilizing the C3- and C5-convertase complexes, leading to membrane attack complex formation and target cell lysis. Mutations in this gene cause properdin deficiency, increasing susceptibility to meningococcal infections.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific COMP Polyclonal Antibody
618,800원
Thermo Fisher Scientific
Thermo Fisher Scientific S100A10 Polyclonal Antibody
618,800원
Thermo Fisher Scientific
Thermo Fisher Scientific Properdin Polyclonal Antibody
618,800원
Thermo Fisher Scientific
Thermo Fisher Scientific KCNMA1 Polyclonal Antibody
618,800원
Thermo Fisher Scientific
Thermo Fisher Scientific NOX4 Polyclonal Antibody
618,800원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|