
Thermo Fisher Scientific Properdin Polyclonal Antibody
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
Tested Dilution
Publications
Western Blot (WB)
0.1-0.5 µg/mL
Immunohistochemistry (Paraffin) (IHC (P))
0.5-1 µg/mL
Immunohistochemistry (Frozen) (IHC (F))
0.5-1 µg/mL
Flow Cytometry (Flow)
1-3 µg/1x10^6 cells
Product Specifications
Species Reactivity
Human, Mouse, Rat
Host/Isotype
Rabbit / IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence of human CFP (MVEGQGEKNVTFWGRPLPRCEELQGQKLVVEEKR). if (typeof window.$mangular === undefined || !window.$mangular) { window.$mangular = {}; } $mangular.antigenJson = \[{targetFamily:Properdin,uniProtId:P27918-1,ncbiNodeId:9606,antigenRange:420-453,antigenLength:469,antigenImageFileName:PA5-95544_Properdin_P27918-1_Rabbit.svg,antigenImageFileNamePDP:PA5-95544_Properdin_P27918-1_Rabbit_PDP.jpeg,sortOrder:1}\]; $mangular.isB2BCMGT = false; $mangular.isEpitopesModalImageMultiSizeEnabled = true;
View immunogen .st0{fill:#FFFFFF;} .st1{fill:#1E8AE7;}
Conjugate
Unconjugated Unconjugated Unconjugated
Form
Lyophilized
Concentration
500 µg/mL
Purification
Affinity chromatography
Storage buffer
PBS with 4mg trehalose
Contains
0.05mg sodium azide
Storage conditions
Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Shipping conditions
Wet ice
RRID
AB_2807346
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
This gene encodes a plasma glycoprotein that positively regulates the alternative complement pathway of the innate immune system. This protein binds to many microbial surfaces and apoptotic cells and stabilizes the C3- and C5-convertase enzyme complexes in a feedback loop that ultimately leads to formation of the membrane attack complex and lysis of the target cell. Mutations in this gene result in two forms of properdin deficiency, which results in high susceptibility to meningococcal infections.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Thermo Fisher Scientific
Thermo Fisher Scientific COMP Polyclonal Antibody
618,800원

Thermo Fisher Scientific
Thermo Fisher Scientific S100A10 Polyclonal Antibody
618,800원

Thermo Fisher Scientific
Thermo Fisher Scientific Properdin Polyclonal Antibody
618,800원

Thermo Fisher Scientific
Thermo Fisher Scientific KCNMA1 Polyclonal Antibody
618,800원

Thermo Fisher Scientific
Thermo Fisher Scientific NOX4 Polyclonal Antibody
618,800원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
