Thermo Fisher Scientific NOX4 Polyclonal Antibody
Thermo Fisher Scientific의 NOX4 Polyclonal Antibody는 인간, 마우스, 랫트에서 반응하며 Western blot과 IHC(P) 분석에 적합합니다. Rabbit IgG 기반의 비결합 항체로, 합성 펩타이드 항원으로 제작되었습니다. 친화 크로마토그래피로 정제되었으며, 4°C 단기 보관 및 -20°C 장기 보관이 권장됩니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence of human NADPH oxidase 4 (ILNTLLDDWKPYKLRRLYFIWVCRDIQSFRWFADLL). |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Affinity chromatography |
| Storage buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage conditions | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
| Shipping conditions | Wet ice |
| RRID | AB_2807305 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Oxygen sensing is essential for homeostasis in all aerobic organisms. A phagocyte-type oxidase, similar to that responsible for the production of large amounts of reactive oxygen species (ROS) in neutrophil granulocytes with resultant antimicrobial activity, has been postulated to function in the kidney as an oxygen sensor regulating erythropoietin synthesis in the renal cortex.
NOX4 acts as a redox messenger in intracellular signaling pathways leading to mitochondriogenesis, cell survival, and differentiation in hematopoietic stem cells. Data suggest that NOX4 links the insulin receptor to ROS generation, enhancing insulin signal transduction.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific Properdin Polyclonal Antibody
618,800원
Thermo Fisher Scientific
Thermo Fisher Scientific KCNMA1 Polyclonal Antibody
618,800원
Thermo Fisher Scientific
Thermo Fisher Scientific NOX4 Polyclonal Antibody
618,800원
Thermo Fisher Scientific
Thermo Fisher Scientific Urokinase Polyclonal Antibody
618,800원
Thermo Fisher Scientific
Thermo Fisher Scientific IL-1 beta Polyclonal Antibody
618,800원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|