
Atlas Antibodies Anti-TOMM40L Antibody
상품 한눈에 보기
Human TOMM40L 단백질을 인식하는 Rabbit Polyclonal 항체로, Affinity purification 방식으로 정제됨. IHC 등 다양한 응용에 적합하며, 높은 종간 보존성을 가짐. FLJ12770, TOMM40B 유전자 대체명 포함.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-TOMM40L Antibody
Target: translocase of outer mitochondrial membrane 40 homolog (yeast)-like
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
Product Description
Polyclonal antibody against Human TOMM40L.
Alternative Gene Names
- FLJ12770
- TOMM40B
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | translocase of outer mitochondrial membrane 40 homolog (yeast)-like |
| Target Gene | TOMM40L |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | VVNKVLSSHFQVAHTIHMSALGLPGYHLHAAYAGDWQLSPTEVFPTVVGDM |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000003398 (96%), Mouse ENSMUSG00000005674 (96%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 구성 성분 | 내용 |
|---|---|
| Base Buffer | PBS (pH 7.2) |
| Additives | 40% glycerol, 0.02% sodium azide (preservative) |
| MSDS | Material Safety Data Sheet |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 최적의 농도 및 조건은 사용자가 실험에 따라 결정해야 합니다.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-TOMM22 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TOMM5 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TOMM40L Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TOMM40 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TOMM34 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.