CacheBy
Atlas Antibodies Anti-TOMM40L Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TOMM40L Antibody

상품 한눈에 보기

Human TOMM40L 단백질을 인식하는 Rabbit Polyclonal 항체로, Affinity purification 방식으로 정제됨. IHC 등 다양한 응용에 적합하며, 높은 종간 보존성을 가짐. FLJ12770, TOMM40B 유전자 대체명 포함.

카탈로그번호
HPA051304-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA051304-100 Anti-TOMM40L Antibody, translocase of outer mitochondrial membrane 40 homolog (yeast)-like 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA051304-25 Anti-TOMM40L Antibody, translocase of outer mitochondrial membrane 40 homolog (yeast)-like 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TOMM40L Antibody

Anti-TOMM40L Antibody

Target: translocase of outer mitochondrial membrane 40 homolog (yeast)-like
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against Human TOMM40L.


Alternative Gene Names

  • FLJ12770
  • TOMM40B

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein translocase of outer mitochondrial membrane 40 homolog (yeast)-like
Target Gene TOMM40L
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence VVNKVLSSHFQVAHTIHMSALGLPGYHLHAAYAGDWQLSPTEVFPTVVGDM
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000003398 (96%), Mouse ENSMUSG00000005674 (96%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 성분 내용
Base Buffer PBS (pH 7.2)
Additives 40% glycerol, 0.02% sodium azide (preservative)
MSDS Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 최적의 농도 및 조건은 사용자가 실험에 따라 결정해야 합니다.

제품 이미지

IHC Application Icon

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.