CacheBy
Atlas Antibodies Anti-TOMM40 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TOMM40 Antibody

상품 한눈에 보기

Human TOMM40 단백질을 인식하는 rabbit polyclonal antibody로, IHC, WB, ICC에 적합. PrEST 항원을 이용한 친화정제 방식으로 높은 특이성과 재현성 제공. 40% glycerol PBS 버퍼에 보존제로 sodium azide 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA036232-100 Anti-TOMM40 Antibody, translocase of outer mitochondrial membrane 40 homolog (yeast) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036232-25 Anti-TOMM40 Antibody, translocase of outer mitochondrial membrane 40 homolog (yeast) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TOMM40 Antibody

Anti-TOMM40 Antibody

Target: translocase of outer mitochondrial membrane 40 homolog (yeast)
Supplier: Atlas Antibodies

  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human TOMM40.

Alternative Gene Names

C19orf1, D19S1177E, PER-EC1, PEREC1, TOM40

Open Datasheet

Target Information

항목 내용
Target Protein translocase of outer mitochondrial membrane 40 homolog (yeast)
Target Gene TOMM40
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence FTLPPLGGSLGAGTSTSRSSERTPGAATASASGAAEDGACGCLPNPGTFEECHRKCKELFPIQM
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000002984 (80%)
Rat ENSRNOG00000018556 (73%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC
WB
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.