
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-TOMM40 Antibody
상품 한눈에 보기
Human TOMM40 단백질을 인식하는 rabbit polyclonal antibody로, IHC, WB, ICC에 적합. PrEST 항원을 이용한 친화정제 방식으로 높은 특이성과 재현성 제공. 40% glycerol PBS 버퍼에 보존제로 sodium azide 포함.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA036232-100 Anti-TOMM40 Antibody, translocase of outer mitochondrial membrane 40 homolog (yeast) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036232-25 Anti-TOMM40 Antibody, translocase of outer mitochondrial membrane 40 homolog (yeast) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-TOMM40 Antibody
Anti-TOMM40 Antibody
Target: translocase of outer mitochondrial membrane 40 homolog (yeast)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against Human TOMM40.
Alternative Gene Names
C19orf1, D19S1177E, PER-EC1, PEREC1, TOM40
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | translocase of outer mitochondrial membrane 40 homolog (yeast) |
| Target Gene | TOMM40 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | FTLPPLGGSLGAGTSTSRSSERTPGAATASASGAAEDGACGCLPNPGTFEECHRKCKELFPIQM |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000002984 (80%) Rat ENSRNOG00000018556 (73%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



