Atlas Antibodies Anti-TOMM5 Antibody
| 상품 옵션 정보 | ||||||||
|---|---|---|---|---|---|---|---|---|
| 카탈로그 번호 | CAS 번호 | 설명 | 상태 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
| HPA048712-100 | - | Atlas Antibodies HPA048712-100 Anti-TOMM5 Antibody, translocase of outer mitochondrial membrane 5 homolog (yeast) 100ul | 재고문의 | 100ul | 728,000원 | - | 800,800원 | |
| HPA048712-25 | - | Atlas Antibodies HPA048712-25 Anti-TOMM5 Antibody, translocase of outer mitochondrial membrane 5 homolog (yeast) 25ul | 재고문의 | 25ul | 528,000원 | - | 580,800원 | |
다른 상품 둘러보기
Anti-TOMM5 Antibody
translocase of outer mitochondrial membrane 5 homolog (yeast)
Recommended Applications
Product Description
Polyclonal Antibody against Human TOMM5
Alternative Gene Names
bA613M10.3, C9orf105
Target Protein
translocase of outer mitochondrial membrane 5 homolog (yeast)
Target Gene
TOMM5
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Copy sequence to clipboard
RIEGLAPKLDPEEMKRKMREDVISSIRNFLIYVALLRVTPFILKKLD
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
Mouse ENSMUSG00000078713 (96%)
Rat ENSRNOG00000062108 (96%)
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. [Material Safety Data Sheet](https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf Material Safety Data Sheet)
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제 방법 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|