CacheBy
Atlas Antibodies Anti-TOMM5 Antibody
원본

Atlas Antibodies Anti-TOMM5 Antibody

상품 한눈에 보기

Human TOMM5 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC 분석에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 보존성을 보입니다. 40% 글리세롤 및 PBS 완충액에 보존되어 안정성이 우수합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA048712-100 Anti-TOMM5 Antibody, translocase of outer mitochondrial membrane 5 homolog (yeast) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA048712-25 Anti-TOMM5 Antibody, translocase of outer mitochondrial membrane 5 homolog (yeast) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TOMM5 Antibody

Anti-TOMM5 Antibody

Target: translocase of outer mitochondrial membrane 5 homolog (yeast)

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human TOMM5.

Alternative Gene Names

bA613M10.3, C9orf105

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein translocase of outer mitochondrial membrane 5 homolog (yeast)
Target Gene TOMM5
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence RIEGLAPKLDPEEMKRKMREDVISSIRNFLIYVALLRVTPFILKKLD

Verified Species Reactivity

  • Human

Interspecies Information

유전자 ID 항원 서열 유사도
Mouse ENSMUSG00000078713 96%
Rat ENSRNOG00000062108 96%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 최적의 농도 및 조건은 사용자가 실험 환경에 맞게 결정해야 합니다.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.