CacheBy
Atlas Antibodies Anti-TOMM34 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TOMM34 Antibody

상품 한눈에 보기

Human TOMM34 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC 등 다양한 응용에 적합합니다. 정제된 PrEST 항원을 사용하여 높은 특이성과 재현성을 제공합니다. 인체 단백질 발현을 RNA-seq 데이터와 비교하여 정교하게 검증되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA056875-100 Anti-TOMM34 Antibody, translocase of outer mitochondrial membrane 34 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA056875-25 Anti-TOMM34 Antibody, translocase of outer mitochondrial membrane 34 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TOMM34 Antibody

Anti-TOMM34 Antibody

Target: Translocase of Outer Mitochondrial Membrane 34 (TOMM34)
Supplier: Atlas Antibodies


  • IHC Orthogonal Validation: Protein expression verified using immunohistochemistry (IHC) and compared to RNA-seq data in tissues with high and low expression.
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against human TOMM34.


Alternative Gene Names

HTOM34P, TOM34

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Translocase of outer mitochondrial membrane 34
Target Gene TOMM34
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence LCYLVLKQYTEAVKDCTEALKLDGKNVKAFYRRAQAHKALKDYKSSFADISNLLQIEPRNGPAQKLRQEVKQNL
Verified Species Reactivity Human
Interspecies Identity Mouse (ENSMUSG00000018322, 89%), Rat (ENSRNOG00000029799, 88%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Validation Tooltip
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.