CacheBy
Atlas Antibodies Anti-TNS3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TNS3 Antibody

상품 한눈에 보기

Human TNS3 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC에 적합합니다. Orthogonal validation을 통해 검증되었으며, Affinity purified 방식으로 높은 특이성과 재현성을 제공합니다. Glycerol 기반 buffer에 보존되어 안정적입니다.

카탈로그번호
HPA055338-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA055338-100 Anti-TNS3 Antibody, tensin 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA055338-25 Anti-TNS3 Antibody, tensin 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TNS3 Antibody

Anti-TNS3 Antibody

Target Protein: tensin 3
Supplier: Atlas Antibodies

  • Immunohistochemistry (IHC)
  • Western Blot (WB, Orthogonal validation)
  • Immunocytochemistry (ICC)

Orthogonal validation:
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Product Description

Polyclonal Antibody against Human TNS3

Alternative Gene Names

FLJ13732, H_NH0549I23.2, TEM6, TENS1

Open Datasheet (PDF)

Antigen Information

  • Antigen Sequence Type: Recombinant Protein Epitope Signature Tag (PrEST)
  • Sequence:
    HLGPFTCHKSSQNSLLSDGFGSNVGEDPQGTLVPDLGLGMDGPYERERTFGSREPKQPQPLLRKPSVSAQMQAYGQSSYSTQTWVRQQQMVVAHQYSFAPDGEAR

Verified Species Reactivity

  • Human

Interspecies Information

Species Ortholog ID Sequence Identity
Mouse ENSMUSG00000020422 75%
Rat ENSRNOG00000025695 75%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC
WB Orthogonal
Orthogonal Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.