
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-TNS3 Antibody
상품 한눈에 보기
Human TNS3 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC에 적합합니다. Orthogonal validation을 통해 검증되었으며, Affinity purified 방식으로 높은 특이성과 재현성을 제공합니다. Glycerol 기반 buffer에 보존되어 안정적입니다.
- 카탈로그번호
- HPA055338-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA055338-100 Anti-TNS3 Antibody, tensin 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA055338-25 Anti-TNS3 Antibody, tensin 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-TNS3 Antibody
Anti-TNS3 Antibody
Target Protein: tensin 3
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB, Orthogonal validation)
- Immunocytochemistry (ICC)
Orthogonal validation:
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
Product Description
Polyclonal Antibody against Human TNS3
Alternative Gene Names
FLJ13732, H_NH0549I23.2, TEM6, TENS1
Antigen Information
- Antigen Sequence Type: Recombinant Protein Epitope Signature Tag (PrEST)
- Sequence:
HLGPFTCHKSSQNSLLSDGFGSNVGEDPQGTLVPDLGLGMDGPYERERTFGSREPKQPQPLLRKPSVSAQMQAYGQSSYSTQTWVRQQQMVVAHQYSFAPDGEAR
Verified Species Reactivity
- Human
Interspecies Information
| Species | Ortholog ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000020422 | 75% |
| Rat | ENSRNOG00000025695 | 75% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



