CacheBy
Atlas Antibodies Anti-TOLLIP Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TOLLIP Antibody

상품 한눈에 보기

Human TOLLIP 단백질을 인식하는 폴리클로날 토끼 항체로, IHC, WB, ICC 등 다양한 응용에 적합함. siRNA knockdown 및 독립 항체 비교를 통한 검증 완료. 고순도 Affinity 정제 및 안정적인 PBS/glycerol buffer 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA038622-100 Anti-TOLLIP Antibody, toll interacting protein 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA038622-25 Anti-TOLLIP Antibody, toll interacting protein 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TOLLIP Antibody

Anti-TOLLIP Antibody

Target: toll interacting protein (TOLLIP)
Supplier: Atlas Antibodies


  • IHC (Independent Validation): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
  • WB (Genetic Validation): Genetic validation in WB by siRNA knockdown.
  • ICC: Suitable for immunocytochemistry applications.

Product Description

Polyclonal Antibody against Human TOLLIP


Alternative Gene Names

  • IL-1RAcPIP

Open Datasheet


Antigen Information

  • Target Protein: toll interacting protein
  • Target Gene: TOLLIP
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    VEDKWYSLSGRQGDDKEGMINLVMSYALLPAAMVMPPQPVVLMPTVYQQGVGYVPITGMPAVCSPGMVPVALPPAAVNAQPRCSEEDLKA

Verified Species Reactivity

  • Human
  • Rat

Interspecies Information:
Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000025139 (88%)
  • Rat ENSRNOG00000019861 (88%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative.
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.


제품 이미지

Enhanced Validation
IHC Independent
WB Genetic
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.