CacheBy
Atlas Antibodies Anti-TOGARAM1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TOGARAM1 Antibody

상품 한눈에 보기

Human TOGARAM1 단백질을 인식하는 토끼 폴리클로날 항체로, 면역세포화학(ICC) 등 다양한 응용에 적합. PrEST 항원을 이용해 친화 정제되었으며, 인간에 대해 검증됨. Crescerin-1(FAM179B) 등 다양한 유전자명과 관련.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA053559-100 Anti-TOGARAM1 Antibody, TOG array regulator of axonemal microtubules 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA053559-25 Anti-TOGARAM1 Antibody, TOG array regulator of axonemal microtubules 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TOGARAM1 Antibody

Anti-TOGARAM1 Antibody

Target: TOG array regulator of axonemal microtubules 1 (TOGARAM1)
Supplier: Atlas Antibodies


Product Description

Polyclonal antibody against human TOGARAM1.

Alternative Gene Names

crescerin, Crescerin-1, FAM179B, KIAA0423

Target Information

  • Target Protein: TOG array regulator of axonemal microtubules 1
  • Target Gene: TOGARAM1

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

DTDWLLAGNRTQSAHCHCGDHVRDSMHIYGSYSPTICTRRVLSAGKGKNKLPWENEQPGIMGENQTSTSKDIEQFSTYDFIPSAKLKLSQGMPVNDDLCFS

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity
Rat ENSRNOG00000004415 85%
Mouse ENSMUSG00000035614 83%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (Sodium Azide)

면역세포화학(ICC) 등 다양한 면역학적 응용에 적합.

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용에 대한 최적 농도 및 조건은 사용자가 직접 결정해야 합니다.

Open Datasheet (PDF)


제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.