CacheBy
Atlas Antibodies Anti-TOM1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TOM1 Antibody

상품 한눈에 보기

Human TOM1 단백질을 인식하는 Rabbit Polyclonal 항체로, WB 및 ICC에 적합합니다. PrEST 항원을 이용해 Affinity 정제되었으며, PBS와 40% glycerol buffer에 보존됩니다. Human에 반응하며 Mouse 및 Rat과 높은 서열 유사성을 가집니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA000818-100 Anti-TOM1 Antibody, target of myb1 membrane trafficking protein 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA000818-25 Anti-TOM1 Antibody, target of myb1 membrane trafficking protein 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TOM1 Antibody

Anti-TOM1 Antibody

Target: target of myb1 membrane trafficking protein
Type: Polyclonal Antibody against Human TOM1

  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

This polyclonal antibody is raised in rabbit and targets the human TOM1 (target of myb1 membrane trafficking protein).
Open Datasheet (PDF)

Target Information

항목 내용
Target Protein target of myb1 membrane trafficking protein
Target Gene TOM1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence LSGDTPIAPTPEQIGKLRSELEMVSGNVRVMSEMLTELVPTQAEPADLELLQELNRTCRAMQQRVLELIPQIANEQLTEELLIVNDNLNNVFLRHERFERFRTGQTTKAPSEAEPAADLIDMGPDPAATGNLSSQLAGMNLGSSSVRAGLQSLEASGRLEDEFDMFALTRGSSLADQ

Species Reactivity

반응성
Human Verified
Mouse (ENSMUSG00000042870) 90% sequence identity
Rat (ENSRNOG00000014093) 89% sequence identity

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

구성 성분 내용
Buffer PBS (pH 7.2)
Additives 40% glycerol, 0.02% sodium azide (preservative)
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.