
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-TOM1 Antibody
상품 한눈에 보기
Human TOM1 단백질을 인식하는 Rabbit Polyclonal 항체로, WB 및 ICC에 적합합니다. PrEST 항원을 이용해 Affinity 정제되었으며, PBS와 40% glycerol buffer에 보존됩니다. Human에 반응하며 Mouse 및 Rat과 높은 서열 유사성을 가집니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA000818-100 Anti-TOM1 Antibody, target of myb1 membrane trafficking protein 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA000818-25 Anti-TOM1 Antibody, target of myb1 membrane trafficking protein 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-TOM1 Antibody
Anti-TOM1 Antibody
Target: target of myb1 membrane trafficking protein
Type: Polyclonal Antibody against Human TOM1
Recommended Applications
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
This polyclonal antibody is raised in rabbit and targets the human TOM1 (target of myb1 membrane trafficking protein).
Open Datasheet (PDF)
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | target of myb1 membrane trafficking protein |
| Target Gene | TOM1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | LSGDTPIAPTPEQIGKLRSELEMVSGNVRVMSEMLTELVPTQAEPADLELLQELNRTCRAMQQRVLELIPQIANEQLTEELLIVNDNLNNVFLRHERFERFRTGQTTKAPSEAEPAADLIDMGPDPAATGNLSSQLAGMNLGSSSVRAGLQSLEASGRLEDEFDMFALTRGSSLADQ |
Species Reactivity
| 종 | 반응성 |
|---|---|
| Human | Verified |
| Mouse (ENSMUSG00000042870) | 90% sequence identity |
| Rat (ENSRNOG00000014093) | 89% sequence identity |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
| 구성 성분 | 내용 |
|---|---|
| Buffer | PBS (pH 7.2) |
| Additives | 40% glycerol, 0.02% sodium azide (preservative) |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



