
Atlas Antibodies Anti-TOM1 Antibody
상품 한눈에 보기
Human TOM1 단백질을 인식하는 Rabbit Polyclonal 항체로, WB 및 ICC에 적합합니다. PrEST 항원을 이용해 Affinity 정제되었으며, PBS와 40% glycerol buffer에 보존됩니다. Human에 반응하며 Mouse 및 Rat과 높은 서열 유사성을 가집니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-TOM1 Antibody
Target: target of myb1 membrane trafficking protein
Type: Polyclonal Antibody against Human TOM1
Recommended Applications
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
This polyclonal antibody is raised in rabbit and targets the human TOM1 (target of myb1 membrane trafficking protein).
Open Datasheet (PDF)
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | target of myb1 membrane trafficking protein |
| Target Gene | TOM1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | LSGDTPIAPTPEQIGKLRSELEMVSGNVRVMSEMLTELVPTQAEPADLELLQELNRTCRAMQQRVLELIPQIANEQLTEELLIVNDNLNNVFLRHERFERFRTGQTTKAPSEAEPAADLIDMGPDPAATGNLSSQLAGMNLGSSSVRAGLQSLEASGRLEDEFDMFALTRGSSLADQ |
Species Reactivity
| 종 | 반응성 |
|---|---|
| Human | Verified |
| Mouse (ENSMUSG00000042870) | 90% sequence identity |
| Rat (ENSRNOG00000014093) | 89% sequence identity |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
| 구성 성분 | 내용 |
|---|---|
| Buffer | PBS (pH 7.2) |
| Additives | 40% glycerol, 0.02% sodium azide (preservative) |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-TOGARAM2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TOM1L2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TOM1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TOLLIP Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TNS3 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.